PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC08G12870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 453aa    MW: 46037 Da    PI: 7.7908
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC08G12870.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65e-32254307255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  OPUNC08G12870.1 254 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 307
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-15251308IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28252308IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23254307IPR006447Myb domain, plants
PfamPF002496.8E-7255306IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MASATTPDLS LHISLPSGGA AGAGTATPGL GNGGAGTGRG GAGGKPAGDP WRRLDGSTAS  60
TELSLSTPQQ QQEEGSTAAD VLPWRLRQPT AAAAAAPVPV TLPTIPMDGS AAARPIRGVP  120
VYSSAGGGHP FLGGGGGDHR HNRLYNPYHS TAWPSSSPAP APPPPPAALD PTSSLLSPSA  180
YHRMLSSTGR LHGVLADTLR GYAGAAAAGS IGYGSAAAAA AAAAMGGYGG GGGIASSRFM  240
PRLLPASRRS MRAPRMRWTS SLHARFVHAV ELLGGHERAT PKSVLELMDV KDLTLAHVKS  300
HLQMYRTVKS TDKPAAASGP MDGSGSGSGS GDDELLAGEG RQATSSGADA DRRMLFPEHR  360
SSSDGAASHA GGGGDGDCSS SAVNSDTIRA RSNSPRDLWL SSSVCNMDPQ RLVTVEDMEP  420
CRSSSLQVSG HELSCPSLEF TLGRPSWHSI DHD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2877880.0AK287788.1 Oryza sativa Japonica Group cDNA, clone: J065172N06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648273.10.0PREDICTED: probable transcription factor RL9
SwissprotQ0J2351e-103ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A0E0LUU40.0A0A0E0LUU4_ORYPU; Uncharacterized protein
STRINGORGLA08G0133500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-35G2-like family protein